PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10009634m
Common NameEUTSA_v10009634mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family SRS
Protein Properties Length: 347aa    MW: 37607 Da    PI: 6.7253
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10009634mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702224.52.1e-691142732154
           DUF702   2 rsgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasa........aeaaskrkrelkskkqsals 87 
                      r+g+++CqdCGnqakkdC h+RCRtCCksrgfdC+thvkstWvpaakrrerq+ql+ + sk++++a        ++++ + +r +   + sa +
  Thhalv10009634m 114 RQGSMNCQDCGNQAKKDCPHMRCRTCCKSRGFDCQTHVKSTWVPAAKRRERQAQLTGLPSKRSREAssgggdddDDDRDNGNRGQGGGSGSAFA 207
                      7899****************************************************99988888777787754433444444445677889999 PP

           DUF702  88 stklssaeskkeletsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                      +t++++a+s+  le s+lP+e+s +avf+c+rvss+dd++ee+aYqtavsigGhvfkGiLydqG+++
  Thhalv10009634m 208 CTRVVNASSS-GLESSHLPPEMSLPAVFQCMRVSSIDDEDEEYAYQTAVSIGGHVFKGILYDQGPSD 273
                      ***9999765.99999************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051424.2E-63117272IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016231.1E-27119161IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016241.7E-24223271IPR006511Lateral Root Primordium type 1, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009299Biological ProcessmRNA transcription
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 347 aa     Download sequence    Send to blast
MAGLFYLGGR EDSKQDLHHQ NKDNSEDKSN NYLYLYKDEI YNNNKGFEIW PPQYFQHQQQ  60
QSPVAPTTNF YSFGMVPSGG SNNNNRGTNR SLYFNVVSDH EPVRSATGGF TVTRQGSMNC  120
QDCGNQAKKD CPHMRCRTCC KSRGFDCQTH VKSTWVPAAK RRERQAQLTG LPSKRSREAS  180
SGGGDDDDDD RDNGNRGQGG GSGSAFACTR VVNASSSGLE SSHLPPEMSL PAVFQCMRVS  240
SIDDEDEEYA YQTAVSIGGH VFKGILYDQG PSDHRYSSSP TATATETSQH HLNLLASTAS  300
AATTTAVTAS NINNATIDPS SLYTAATTPF NAFVAAGTPF FAPPRS*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00152DAPTransfer from AT1G19790Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGU2052680.0GU205268.1 Brassica rapa subsp. pekinensis short internode related sequence 7 (SRS7) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006416463.10.0hypothetical protein EUTSA_v10009634mg
SwissprotQ9FXH70.0SRS7_ARATH; Protein SHI RELATED SEQUENCE 7
TrEMBLV4MSL50.0V4MSL5_EUTSA; Uncharacterized protein
STRINGBra025768.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM26452572
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19790.21e-163SHI-related sequence 7